PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g015130.1
Common NameMTR_4g015130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 85aa    MW: 9836.36 Da    PI: 10.3995
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g015130.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-072381147
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +++ + k++G+g+W+ I++ + ++R   q+ s+ qky
  Medtr4g015130.1  2 KFLMGLKKYGKGDWRNISHDFVTTRIQTQVASHAQKY 38
                     79999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.791143IPR017930Myb domain
TIGRFAMsTIGR015571.3E-9242IPR006447Myb domain, plants
SuperFamilySSF466894.01E-8244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-5242IPR009057Homeodomain-like
CDDcd001678.79E-4239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKFLMGLKKY GKGDWRNISH DFVTTRIQTQ VASHAQKYFI RQQNGGKDKR RSSIHDITMM  60
NLHETNSSSL EMNNILMYLI TICN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2032241e-140AC203224.21 Medicago truncatula clone mth2-152n14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003604620.19e-58MYB family transcription factor
SwissprotQ8S9H72e-31DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLG7JMZ11e-57G7JMZ1_MEDTR; MYB family transcription factor
STRINGGLYMA03G14440.12e-33(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1677748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-33Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]